Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Ornithine transcarbamoylase [53676] (6 species) |
Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries) |
Domain d1orth1: 1ort H:1-150 [35218] |
PDB Entry: 1ort (more details), 3 Å
SCOPe Domain Sequences for d1orth1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orth1 c.78.1.1 (H:1-150) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} afnmhnrnllslmhhstrelrylldlsrdlkrakytgteqqhlkrknialifektstrtr cafevaaydqganvtyidpnssqighkesmkdtarvlgrmydaigyrgfkqeiveelakf agvpvfngltdeyhptqmladvltmrehsd
Timeline for d1orth1: