Lineage for d5np8a_ (5np8 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. Protein automated matches [190709] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188478] (25 PDB entries)
  8. Domain d5np8a_: 5np8 A: [352177]
    automated match to d4o33a_
    complexed with 3pg, 93t, edo

Details for d5np8a_

PDB Entry: 5np8 (more details), 1.9 Å

PDB Description: pgk1 in complex with crt0063465 (3-[2-(4-bromophenyl)-5,7-dimethyl- pyrazolo[1,5-a]pyrimidin-6-yl]propanoic acid)
PDB Compounds: (A:) Phosphoglycerate kinase 1

SCOPe Domain Sequences for d5np8a_:

Sequence, based on SEQRES records: (download)

>d5np8a_ c.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlmshl
grpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenlrf
hveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlpqk
aggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftf
lkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatva
sgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkats
rgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni

Sequence, based on observed residues (ATOM records): (download)

>d5np8a_ c.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlmshl
grpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenlrf
hveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlpqk
aggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaftf
lkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqatva
sgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvkats
rgcitiigkwntedkvshvstgggaslellegkvlpgvdalsni

SCOPe Domain Coordinates for d5np8a_ are not available.

Timeline for d5np8a_: