SCOPe 2.07: Domain d5np5a1: 5np5 A:64-120

Lineage for d5np5a1 (5np5 A:64-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)

8. Domain d5np5a1: 5np5 A:64-120 [352171]
   Other proteins in same PDB: d5np5a2
   automated match to d1fyna_
   complexed with so4

Details for d5np5a1

PDB Entry: 5np5, 1.4 Å

PDB Description: abl2 sh3 ptyr116/161

PDB Compounds: (A:) Abelson tyrosine-protein kinase 2

SCOPe Domain Sequences for d5np5a1:

Sequence; same for both SEQRES and ATOM records:

>d5np5a1 b.34.2.0 (A:64-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn

Timeline for d5np5a1:

• d5np5a1 is new in SCOPe 2.07-stable
  
• d5np5a1 appears in the current release, SCOPe 2.08