Lineage for d5np3a_ (5np3 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2393062Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)
  8. 2393151Domain d5np3a_: 5np3 A: [352165]
    Other proteins in same PDB: d5np3b2, d5np3d2
    automated match to d1fyna_

Details for d5np3a_

PDB Entry: 5np3 (more details), 2 Å

PDB Description: abl2 sh3
PDB Compounds: (A:) Abelson tyrosine-protein kinase 2

SCOPe Domain Sequences for d5np3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5np3a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlfvalydfvasgdntlsitkgeklrvlgynqngewsevrskngqgwvpsnyitpvn

SCOPe Domain Coordinates for d5np3a_:

Click to download the PDB-style file with coordinates for d5np3a_.
(The format of our PDB-style files is described here.)

Timeline for d5np3a_: