Lineage for d5o3sa1 (5o3s A:2-110)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. Protein automated matches [190753] (21 species)
    not a true protein
  7. Species Synechocystis sp. [TaxId:1111708] [352162] (4 PDB entries)
  8. Domain d5o3sa1: 5o3s A:2-110 [352163]
    Other proteins in same PDB: d5o3sa2
    automated match to d3dfeb_

Details for d5o3sa1

PDB Entry: 5o3s (more details), 2.2 Å

PDB Description: carbon regulatory pii-like protein sbtb from synechocystis sp. 6803 in apo state, hexagonal crystal form
PDB Compounds: (A:) Membrane-associated protein slr1513

SCOPe Domain Sequences for d5o3sa1:

Sequence, based on SEQRES records: (download)

>d5o3sa1 d.58.5.0 (A:2-110) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieanik
feiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegc

Sequence, based on observed residues (ATOM records): (download)

>d5o3sa1 d.58.5.0 (A:2-110) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkieanikfeiltetremaeeia
drvavkyfndyagiiyicsaevlyghtfcgpegc

SCOPe Domain Coordinates for d5o3sa1 are not available.

Timeline for d5o3sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o3sa2