Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Francisella tularensis [TaxId:263] [352126] (2 PDB entries) |
Domain d5nhka_: 5nhk A: [352155] automated match to d2fe3a_ complexed with fe, zn |
PDB Entry: 5nhk (more details), 1.8 Å
SCOPe Domain Sequences for d5nhka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nhka_ a.4.5.0 (A:) automated matches {Francisella tularensis [TaxId: 263]} dlkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvlnqfesag iinrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidys lniyvkckscr
Timeline for d5nhka_: