Lineage for d5nhka_ (5nhk A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308172Species Francisella tularensis [TaxId:263] [352126] (2 PDB entries)
  8. 2308177Domain d5nhka_: 5nhk A: [352155]
    automated match to d2fe3a_
    complexed with fe, zn

Details for d5nhka_

PDB Entry: 5nhk (more details), 1.8 Å

PDB Description: structure of ferric uptake regulator from francisella tularensis with iron
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d5nhka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhka_ a.4.5.0 (A:) automated matches {Francisella tularensis [TaxId: 263]}
dlkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvlnqfesag
iinrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidys
lniyvkckscr

SCOPe Domain Coordinates for d5nhka_:

Click to download the PDB-style file with coordinates for d5nhka_.
(The format of our PDB-style files is described here.)

Timeline for d5nhka_: