Lineage for d5nbcc_ (5nbc C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. Protein automated matches [190154] (91 species)
    not a true protein
  7. Species Francisella tularensis [TaxId:263] [352126] (2 PDB entries)
  8. Domain d5nbcc_: 5nbc C: [352152]
    automated match to d2fe3a_
    complexed with mn, zn

Details for d5nbcc_

PDB Entry: 5nbc (more details), 1.7000000000000002 Å

PDB Description: structure of prokaryotic transcription factors
PDB Compounds: (C:) ferric uptake regulation protein

SCOPe Domain Sequences for d5nbcc_:

Sequence, based on SEQRES records: (download)

>d5nbcc_ a.4.5.0 (C:) automated matches {Francisella tularensis [TaxId: 263]}
fkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvlnqfesagiinrlk
ldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidyslniyvk
ckscre

Sequence, based on observed residues (ATOM records): (download)

>d5nbcc_ a.4.5.0 (C:) automated matches {Francisella tularensis [TaxId: 263]}
fkvtqprveilklfekkdkhlspddvfsklkaqgsttgiatvyrvlnqfesagiinrlkl
dneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidyslniyvkc
kscre

SCOPe Domain Coordinates for d5nbcc_ are not available.

Timeline for d5nbcc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nbca_, d5nbcb_, d5nbcd_