Lineage for d5nhxa_ (5nhx A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. Protein automated matches [195455] (14 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [352148] (1 PDB entry)
  8. Domain d5nhxa_: 5nhx A: [352149]
    automated match to d4rhaa_
    complexed with cit

Details for d5nhxa_

PDB Entry: 5nhx (more details), 1.95 Å

PDB Description: periplasmic domain of outer membrane protein a from klebsiella pneumoniae
PDB Compounds: (A:) outer membrane protein a

SCOPe Domain Sequences for d5nhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhxa_ d.79.7.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
atkhftlksdvlfnfnkatlkpegqqaldqlytqlsnmdpkdgsavvlgytdrigseayn
qqlsekraqsvvdylvakgipagkisargmgesnpvtgntcdnvkaraalidclapdrrv
eievkg

SCOPe Domain Coordinates for d5nhxa_ are not available.

Timeline for d5nhxa_: