Lineage for d6c1ka_ (6c1k A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. Protein NavAb sodium channel [310744] (1 species)
  7. Species Arcobacter butzleri [TaxId:367737] [310997] (16 PDB entries)
  8. Domain d6c1ka_: 6c1k A: [352141]
    automated match to d3rvya_
    complexed with gai, na, px4, so4; mutant

Details for d6c1ka_

PDB Entry: 6c1k (more details), 2.7 Å

PDB Description: hypopp mutant with ligand1
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d6c1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c1ka_ f.14.1.2 (A:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlgvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvdam

SCOPe Domain Coordinates for d6c1ka_ are not available.

Timeline for d6c1ka_:

Domains from other chains:
(mouse over for more information)
d6c1kb_