![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225088] (3 PDB entries) |
![]() | Domain d6eryb2: 6ery B:447-596 [352124] Other proteins in same PDB: d6erya1, d6erya3, d6eryb1, d6eryb3 automated match to d3tgza2 complexed with so4 |
PDB Entry: 6ery (more details), 1.8 Å
SCOPe Domain Sequences for d6eryb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eryb2 a.45.1.0 (B:447-596) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rypklgtqhpesnsagndvfakfsafikntkkdaneiyeknllralkkldsylnsplpde idadssedvtvsqrkfldgdeltladcnllpklhiikivakkyrdfefpsemtgiwryln nayardeftntcpadreiehaysdaakrmk
Timeline for d6eryb2: