SCOPe 2.08: Domain d6eryb2: 6ery B:447-596

Lineage for d6eryb2 (6ery B:447-596)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225088] (3 PDB entries)

8. Domain d6eryb2: 6ery B:447-596 [352124]
   Other proteins in same PDB: d6erya1, d6erya3, d6eryb1, d6eryb3
   automated match to d3tgza2
   complexed with so4

Details for d6eryb2

PDB Entry: 6ery, 1.8 Å

PDB Description: the crystal structure of mouse chloride intracellular channel protein 6

PDB Compounds: (B:) Chloride intracellular channel protein 6

SCOPe Domain Sequences for d6eryb2:

Sequence; same for both SEQRES and ATOM records:

>d6eryb2 a.45.1.0 (B:447-596) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rypklgtqhpesnsagndvfakfsafikntkkdaneiyeknllralkkldsylnsplpde
idadssedvtvsqrkfldgdeltladcnllpklhiikivakkyrdfefpsemtgiwryln
nayardeftntcpadreiehaysdaakrmk

Timeline for d6eryb2:

• d6eryb2 first appeared in SCOPe 2.07