Lineage for d6eryb1 (6ery B:363-446)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879989Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)
  8. 2879999Domain d6eryb1: 6ery B:363-446 [352123]
    Other proteins in same PDB: d6erya2, d6erya3, d6eryb2, d6eryb3
    automated match to d3tgza1
    complexed with so4

Details for d6eryb1

PDB Entry: 6ery (more details), 1.8 Å

PDB Description: the crystal structure of mouse chloride intracellular channel protein 6
PDB Compounds: (B:) Chloride intracellular channel protein 6

SCOPe Domain Sequences for d6eryb1:

Sequence, based on SEQRES records: (download)

>d6eryb1 c.47.1.0 (B:363-446) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtnppfm
tfdgevktdvnkieefleeklvpp

Sequence, based on observed residues (ATOM records): (download)

>d6eryb1 c.47.1.0 (B:363-446) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlnlapgtnppfmtfdgevkt
dvnkieefleeklvpp

SCOPe Domain Coordinates for d6eryb1:

Click to download the PDB-style file with coordinates for d6eryb1.
(The format of our PDB-style files is described here.)

Timeline for d6eryb1: