Lineage for d6fuua_ (6fuu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694844Species Lactococcus lactis [TaxId:1359] [352121] (1 PDB entry)
  8. 2694845Domain d6fuua_: 6fuu A: [352122]
    automated match to d3f8fa_
    protein/DNA complex; complexed with hem

Details for d6fuua_

PDB Entry: 6fuu (more details), 1.75 Å

PDB Description: transcriptional regulator lmrr with bound heme
PDB Compounds: (A:) Transcriptional regulator PadR family

SCOPe Domain Sequences for d6fuua_:

Sequence, based on SEQRES records: (download)

>d6fuua_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 1359]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlea

Sequence, based on observed residues (ATOM records): (download)

>d6fuua_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 1359]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdgrrkyyrlteighenmrlafeswsrvdkiienlea

SCOPe Domain Coordinates for d6fuua_:

Click to download the PDB-style file with coordinates for d6fuua_.
(The format of our PDB-style files is described here.)

Timeline for d6fuua_: