SCOPe 2.08: Domain d6fm2a2: 6fm2 A:147-375

Lineage for d6fm2a2 (6fm2 A:147-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d6fm2a2: 6fm2 A:147-375 [352115]
   Other proteins in same PDB: d6fm2b_
   automated match to d1qz5a2
   complexed with adp, hic, mg

Details for d6fm2a2

PDB Entry: 6fm2, 2.8 Å

PDB Description: carp domain of mouse cyclase-associated protein 1 (cap1) bound to adp- actin

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6fm2a2:

Sequence; same for both SEQRES and ATOM records:

>d6fm2a2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

Timeline for d6fm2a2:

• d6fm2a2 first appeared in SCOPe 2.07