Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225088] (3 PDB entries) |
Domain d6erya2: 6ery A:447-594 [352092] Other proteins in same PDB: d6erya1, d6erya3, d6eryb1, d6eryb3 automated match to d3tgza2 complexed with so4 |
PDB Entry: 6ery (more details), 1.8 Å
SCOPe Domain Sequences for d6erya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6erya2 a.45.1.0 (A:447-594) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rypklgtqhpesnsagndvfakfsafikntkkdaneiyeknllralkkldsylnsplpde idadssedvtvsqrkfldgdeltladcnllpklhiikivakkyrdfefpsemtgiwryln nayardeftntcpadreiehaysdaakr
Timeline for d6erya2: