Lineage for d6erya2 (6ery A:447-594)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714085Species Mouse (Mus musculus) [TaxId:10090] [225088] (3 PDB entries)
  8. 2714088Domain d6erya2: 6ery A:447-594 [352092]
    Other proteins in same PDB: d6erya1, d6erya3, d6eryb1, d6eryb3
    automated match to d3tgza2
    complexed with so4

Details for d6erya2

PDB Entry: 6ery (more details), 1.8 Å

PDB Description: the crystal structure of mouse chloride intracellular channel protein 6
PDB Compounds: (A:) Chloride intracellular channel protein 6

SCOPe Domain Sequences for d6erya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6erya2 a.45.1.0 (A:447-594) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rypklgtqhpesnsagndvfakfsafikntkkdaneiyeknllralkkldsylnsplpde
idadssedvtvsqrkfldgdeltladcnllpklhiikivakkyrdfefpsemtgiwryln
nayardeftntcpadreiehaysdaakr

SCOPe Domain Coordinates for d6erya2:

Click to download the PDB-style file with coordinates for d6erya2.
(The format of our PDB-style files is described here.)

Timeline for d6erya2: