SCOPe 2.07: Domain d6erya1: 6ery A:363-446

Lineage for d6erya1 (6ery A:363-446)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)

8. Domain d6erya1: 6ery A:363-446 [352091]
   Other proteins in same PDB: d6erya2, d6erya3, d6eryb2, d6eryb3
   automated match to d3tgza1
   complexed with so4

Details for d6erya1

PDB Entry: 6ery, 1.8 Å

PDB Description: the crystal structure of mouse chloride intracellular channel protein 6

PDB Compounds: (A:) Chloride intracellular channel protein 6

SCOPe Domain Sequences for d6erya1:

Sequence; same for both SEQRES and ATOM records:

>d6erya1 c.47.1.0 (A:363-446) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtnppfm
tfdgevktdvnkieefleeklvpp

Timeline for d6erya1:

• d6erya1 is new in SCOPe 2.07-stable
  
• d6erya1 appears in the current release, SCOPe 2.08