![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries) |
![]() | Domain d6erya1: 6ery A:363-446 [352091] Other proteins in same PDB: d6erya2, d6erya3, d6eryb2, d6eryb3 automated match to d3tgza1 complexed with so4 |
PDB Entry: 6ery (more details), 1.8 Å
SCOPe Domain Sequences for d6erya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6erya1 c.47.1.0 (A:363-446) automated matches {Mouse (Mus musculus) [TaxId: 10090]} itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtnppfm tfdgevktdvnkieefleeklvpp
Timeline for d6erya1: