Lineage for d6f8tb1 (6f8t B:256-578)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2349733Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2350089Protein automated matches [190370] (2 species)
    not a true protein
  7. 2350090Species Human (Homo sapiens) [TaxId:9606] [187208] (37 PDB entries)
  8. 2350110Domain d6f8tb1: 6f8t B:256-578 [352073]
    Other proteins in same PDB: d6f8tb2
    automated match to d1rora_
    complexed with czt, mg, zn

Details for d6f8tb1

PDB Entry: 6f8t (more details), 1.8 Å

PDB Description: crystal structure of the pde4d catalytic domain in complex with gebr- 4a
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6f8tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f8tb1 a.211.1.2 (B:256-578) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl
edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn
qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl
atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly
rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
pdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d6f8tb1:

Click to download the PDB-style file with coordinates for d6f8tb1.
(The format of our PDB-style files is described here.)

Timeline for d6f8tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6f8tb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6f8ta_