SCOPe 2.08: Domain d6f8tb1: 6f8t B:256-578

Lineage for d6f8tb1 (6f8t B:256-578)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
   Uniprot Q08499 388-713

8. Domain d6f8tb1: 6f8t B:256-578 [352073]
   Other proteins in same PDB: d6f8tb2
   automated match to d1rora_
   complexed with czt, mg, zn

Details for d6f8tb1

PDB Entry: 6f8t, 1.8 Å

PDB Description: crystal structure of the pde4d catalytic domain in complex with gebr- 4a

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6f8tb1:

Sequence; same for both SEQRES and ATOM records:

>d6f8tb1 a.211.1.2 (B:256-578) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl
edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn
qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl
atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly
rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
pdaqdildtlednrewyqstipq

Timeline for d6f8tb1:

• d6f8tb1 first appeared in SCOPe 2.07