SCOPe 2.07: Domain d6f8xb_: 6f8x B:

Lineage for d6f8xb_ (6f8x B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (37 PDB entries)

8. Domain d6f8xb_: 6f8x B: [352070]
   automated match to d1rora_
   complexed with d08, dms, edo, mg, zn

Details for d6f8xb_

PDB Entry: 6f8x, 1.95 Å

PDB Description: crystal structure of the pde4d catalytic domain in complex with gebr- 26g

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6f8xb_:

Sequence; same for both SEQRES and ATOM records:

>d6f8xb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl
edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn
qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl
atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly
rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
pdaqdildtlednrewyqstipqa

Timeline for d6f8xb_:

• d6f8xb_ is new in SCOPe 2.07-stable
  
• d6f8xb_ appears in the current release, SCOPe 2.08