Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Gelatinase B (MMP-9) [75496] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) |
Domain d6esma_: 6esm A: [352069] automated match to d4h1qa_ complexed with b9z, ca, pze, zn |
PDB Entry: 6esm (more details), 1.1 Å
SCOPe Domain Sequences for d6esma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6esma_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} gdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfg vaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahqfgha lgldhssvpealmypmyrftegpplhkddvngirhlyg
Timeline for d6esma_: