SCOPe 2.07: Domain d6erza1: 6erz A:5-88

Lineage for d6erza1 (6erz A:5-88)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)

8. Domain d6erza1: 6erz A:5-88 [352062]
   Other proteins in same PDB: d6erza2, d6erza3, d6erzb2, d6erzb3
   automated match to d3tgza1
   complexed with so4, trs

Details for d6erza1

PDB Entry: 6erz, 1.92 Å

PDB Description: the crystal structure of mouse chloride intracellular channel protein 6

PDB Compounds: (A:) Chloride intracellular channel protein 6

SCOPe Domain Sequences for d6erza1:

Sequence, based on SEQRES records:

>d6erza1 c.47.1.0 (A:5-88) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtnppfm
tfdgevktdvnkieefleeklvpp

Sequence, based on observed residues (ATOM records):

>d6erza1 c.47.1.0 (A:5-88) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
itlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdltnppfmtfdgevktdvnki
eefleeklvpp

Timeline for d6erza1:

• d6erza1 is new in SCOPe 2.07-stable
  
• d6erza1 appears in the current release, SCOPe 2.08