SCOPe 2.07: Domain d6enma_: 6enm A:

Lineage for d6enma_ (6enm A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d6enma_: 6enm A: [352061]
   automated match to d5i43b_
   complexed with ca, lpw, zn

Details for d6enma_

PDB Entry: 6enm, 1.59 Å

PDB Description: crystal structure of mmp12 in complex with hydroxamate inhibitor lp168.

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d6enma_:

Sequence; same for both SEQRES and ATOM records:

>d6enma_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
hyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfargahgdd
hafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglghssd
pkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d6enma_:

• d6enma_ is new in SCOPe 2.07-stable
  
• d6enma_ appears in the current release, SCOPe 2.08