SCOPe 2.08: Domain d6cwwa_: 6cww A:

Lineage for d6cwwa_ (6cww A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families)

5. Family d.278.1.1: H-NOX domain [111127] (2 proteins)
   binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
   automatically mapped to Pfam PF07700

6. Protein automated matches [191120] (2 species)
   not a true protein

7. Species Caldanaerobacter subterraneus [TaxId:911092] [352053] (1 PDB entry)

8. Domain d6cwwa_: 6cww A: [352055]
   automated match to d3tf0b_
   complexed with 211, hem; mutant

Details for d6cwwa_

PDB Entry: 6cww, 1.85 Å

PDB Description: cs h-nox mutant with unnatural amino acid 4-cyano-l-phenylalanine at site 5

PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d6cwwa_:

Sequence; same for both SEQRES and ATOM records:

>d6cwwa_ d.278.1.1 (A:) automated matches {Caldanaerobacter subterraneus [TaxId: 911092]}
mkgtxvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfey

Timeline for d6cwwa_:

• d6cwwa_ first appeared in SCOPe 2.07