SCOP 1.73: Domain d1orta2: 1ort A:151-335

Lineage for d1orta2 (1ort A:151-335)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Ornithine transcarbamoylase [53676] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries)

8. Domain d1orta2: 1ort A:151-335 [35205]

Details for d1orta2

PDB Entry: 1ort, 3 Å

PDB Description: ornithine transcarbamoylase from pseudomonas aeruginosa

PDB Compounds: (A:) ornithine transcarbamoylase

SCOP Domain Sequences for d1orta2:

Sequence; same for both SEQRES and ATOM records:

>d1orta2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]}
kplhdisyaylgdarnnmgnsllligaklgmdvriaapkalwphdefvaqckkfaeesga
kltltedpkeavkgvdfvhtdvwvsmgepveawgerikellpyqvnmeimkatgnprakf
mhclpafhnsetkvgkqiaeqypnlangievtedvfespyniafeqaenrmhtikailvs
tladi

Timeline for d1orta2:

• d1orta2 first appeared (with stable ids) in SCOP 1.55
  
• d1orta2 appears in SCOP 1.71
  
• d1orta2 appears in SCOP 1.75
  
• d1orta2 appears in the current release, SCOPe 2.08