![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
![]() | Protein Ornithine transcarbamoylase [53676] (6 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries) |
![]() | Domain d1orta2: 1ort A:151-335 [35205] |
PDB Entry: 1ort (more details), 3 Å
SCOP Domain Sequences for d1orta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orta2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} kplhdisyaylgdarnnmgnsllligaklgmdvriaapkalwphdefvaqckkfaeesga kltltedpkeavkgvdfvhtdvwvsmgepveawgerikellpyqvnmeimkatgnprakf mhclpafhnsetkvgkqiaeqypnlangievtedvfespyniafeqaenrmhtikailvs tladi
Timeline for d1orta2: