Lineage for d6c0bb_ (6c0b B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. Protein automated matches [274417] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries)
  8. Domain d6c0bb_: 6c0b B: [352046]
    automated match to d5urvb_
    complexed with mli, nag, pam

Details for d6c0bb_

PDB Entry: 6c0b (more details), 2.5 Å

PDB Description: structural basis for recognition of frizzled proteins by clostridium difficile toxin b
PDB Compounds: (B:) Frizzled-2

SCOPe Domain Sequences for d6c0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c0bb_ a.141.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhgfcqpisiplctdiaynqtimpnllghtnqedaglevhqfyplvkvqcspelrfflcs
myapvctvleqaippcrsicerarqgcealmnkfgfqwperlrcehfprhgaeqicvgqn
h

SCOPe Domain Coordinates for d6c0bb_ are not available.

Timeline for d6c0bb_: