Lineage for d6c1eb_ (6c1e B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629195Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 2629208Protein NavAb sodium channel [310744] (1 species)
  7. 2629209Species Arcobacter butzleri [TaxId:367737] [310997] (16 PDB entries)
  8. 2629226Domain d6c1eb_: 6c1e B: [352038]
    automated match to d3rvya_
    complexed with bnc, px4, uhh; mutant

Details for d6c1eb_

PDB Entry: 6c1e (more details), 2.86 Å

PDB Description: navab normopp mutant
PDB Compounds: (B:) Ion transport protein

SCOPe Domain Sequences for d6c1eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c1eb_ f.14.1.2 (B:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlglfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvdam

SCOPe Domain Coordinates for d6c1eb_:

Click to download the PDB-style file with coordinates for d6c1eb_.
(The format of our PDB-style files is described here.)

Timeline for d6c1eb_: