Lineage for d6amcc_ (6amc C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907710Species Pyrococcus furiosus [TaxId:186497] [279274] (16 PDB entries)
  8. 2907749Domain d6amcc_: 6amc C: [352029]
    Other proteins in same PDB: d6amcb2
    automated match to d1v8zb_
    complexed with na

Details for d6amcc_

PDB Entry: 6amc (more details), 1.93 Å

PDB Description: engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11
PDB Compounds: (C:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d6amcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6amcc_ c.79.1.1 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvsgn

SCOPe Domain Coordinates for d6amcc_:

Click to download the PDB-style file with coordinates for d6amcc_.
(The format of our PDB-style files is described here.)

Timeline for d6amcc_: