SCOP 1.67: Domain d2at2c2: 2at2 C:145-295

Lineage for d2at2c2 (2at2 C:145-295)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [53675] (1 PDB entry)

8. Domain d2at2c2: 2at2 C:145-295 [35201]
   CA-atoms only

Details for d2at2c2

PDB Entry: 2at2, 3 Å

PDB Description: molecular structure of bacillus subtilis aspartate transcarbamoylase at 3.0 angstroms resolution

SCOP Domain Sequences for d2at2c2:

Sequence; same for both SEQRES and ATOM records:

>d2at2c2 c.78.1.1 (C:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis}
fkgltvsihgdikhsrvarsnaevltrlgarvlfsgpsewqdeentfgtyvsmdeavess
dvvmllriqnerhqsavsqegylnkygltveraermkrhaiimhpapvnrgveiddslve
seksrifkqmkngvfirmaviqcalqtnvkr

Timeline for d2at2c2:

• d2at2c2 first appeared (with stable ids) in SCOP 1.55
  
• d2at2c2 appears in SCOP 1.65
  
• d2at2c2 appears in SCOP 1.69
  
• d2at2c2 appears in the current release, SCOPe 2.08