Lineage for d5xksb_ (5xks B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509689Species Geobacillus sp. [TaxId:1629723] [351942] (1 PDB entry)
  8. 2509691Domain d5xksb_: 5xks B: [352008]
    Other proteins in same PDB: d5xksa2, d5xksc2, d5xksf2
    automated match to d3rm3a_

Details for d5xksb_

PDB Entry: 5xks (more details), 2.19 Å

PDB Description: crystal structure of monoacylglycerol lipase from thermophilic geobacillus sp. 12amor
PDB Compounds: (B:) Thermostable monoacylglycerol lipase

SCOPe Domain Sequences for d5xksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xksb_ c.69.1.0 (B:) automated matches {Geobacillus sp. [TaxId: 1629723]}
mtetypvvkgaepfffegndigilvlhgftgspqsmrplgeayheagytvcgprlkghgt
hyedmekttcqdwidsveagyewlknrcgtifvtglsmggtltlymaehhpeicgiapin
aainmpalagalagvgdlprfldaigsdikkpgvkelayektpaasirqivqlmervktd
lhkitcpailfcsdedhvvppdnapfiydhiasadkklvrlpdsyhvatldndrqkiidt
slaffkkhadr

SCOPe Domain Coordinates for d5xksb_:

Click to download the PDB-style file with coordinates for d5xksb_.
(The format of our PDB-style files is described here.)

Timeline for d5xksb_: