Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (5 PDB entries) |
Domain d5vsuc1: 5vsu C:1-79 [351999] Other proteins in same PDB: d5vsuc2 automated match to d3pggb_ |
PDB Entry: 5vsu (more details), 3.1 Å
SCOPe Domain Sequences for d5vsuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vsuc1 b.38.1.0 (C:1-79) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese rrcemvfirgdtvtlistp
Timeline for d5vsuc1:
View in 3D Domains from other chains: (mouse over for more information) d5vsub_, d5vsue_, d5vsuf_, d5vsug_ |