Lineage for d5wnka_ (5wnk A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [194605] (30 PDB entries)
  8. Domain d5wnka_: 5wnk A: [351996]
    automated match to d3pp0b_
    complexed with b6j, cl

Details for d5wnka_

PDB Entry: 5wnk (more details), 3.11 Å

PDB Description: crystal structure of murine receptor-interacting protein 4 (ripk4) d143n bound to tg100-115
PDB Compounds: (A:) Receptor-interacting serine/threonine-protein kinase 4

SCOPe Domain Sequences for d5wnka_:

Sequence, based on SEQRES records: (download)

>d5wnka_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
algllrtfdagefagwekvgsggfgqvykvrhvhwktwlaikcspslhvddrermellee
akkmemakfryilpvygicqepvglvmeymetgslekllaseplpwdlrfrivhetavgm
nflhcmsppllhlnlkpanilldahyhvkisdfglakcngmshshdlsmdglfgtiaylp
perireksrlfdtkhdvysfaiviwgvltqkkpfadeknilhimmkvvkghrpelppicr
prpracasliglmqrcwhadpqvrptfqeitsetedlce

Sequence, based on observed residues (ATOM records): (download)

>d5wnka_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
algllrtfdagefagwekvgsfgqvykvrhvhwktwlaikcspslhvddrermelleeak
kmemakfryilpvygicqepvglvmeymetgslekllaseplpwdlrfrivhetavgmnf
lhcmsppllhlnlkpanilldahyhvkisdfglakcfgtiaylpperireksrlfdtkhd
vysfaiviwgvltqkkpfadeknilhimmkvvkghrpelppicrprpracasliglmqrc
whadpqvrptfqeitsetedlce

SCOPe Domain Coordinates for d5wnka_ are not available.

Timeline for d5wnka_: