Lineage for d6euab1 (6eua B:242-454)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. Protein automated matches [190726] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187887] (55 PDB entries)
  8. Domain d6euab1: 6eua B:242-454 [351990]
    Other proteins in same PDB: d6euaa2, d6euab2, d6euac2
    automated match to d1jc9a_

Details for d6euab1

PDB Entry: 6eua (more details), 2.1 Å

PDB Description: the fibrinogen-like domain of human angptl3
PDB Compounds: (B:) Angiopoietin-related protein 3

SCOPe Domain Sequences for d6euab1:

Sequence, based on SEQRES records: (download)

>d6euab1 d.171.1.0 (B:242-454) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsqnfnetwen
ykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgnhetnytlh
lvaitgnvpnaipenkdlvfstwdhkakghfncpegysggwwwhdecgennlngkynkpr
akskperrrglswksqngrlysikstkmlihpt

Sequence, based on observed residues (ATOM records): (download)

>d6euab1 d.171.1.0 (B:242-454) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipaecttiynrgehtsgmyairpsnsqvfhvycdvisgspwtliqhridgsqnfnetwen
ykygfgrldgefwlglekiysivkqsnyvlrieledwkdnkhyieysfylgnhetnytlh
lvaitgnvpnaipenkdlvfstwdhkahfncpegysggwwwhdecgennlngkynrglsw
ksqngrlysikstkmlihpt

SCOPe Domain Coordinates for d6euab1 are not available.

Timeline for d6euab1:

Domains from same chain:
(mouse over for more information)
d6euab2
Domains from other chains:
(mouse over for more information)
d6euaa1, d6euaa2, d6euac1, d6euac2