SCOPe 2.08: Domain d2at2b2: 2at2 B:145-295

Lineage for d2at2b2 (2at2 B:145-295)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Bacillus subtilis [TaxId:1423] [53675] (1 PDB entry)

8. Domain d2at2b2: 2at2 B:145-295 [35199]
   CA-atoms only

Details for d2at2b2

PDB Entry: 2at2, 3 Å

PDB Description: molecular structure of bacillus subtilis aspartate transcarbamoylase at 3.0 angstroms resolution

PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d2at2b2:

Sequence; same for both SEQRES and ATOM records:

>d2at2b2 c.78.1.1 (B:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]}
fkgltvsihgdikhsrvarsnaevltrlgarvlfsgpsewqdeentfgtyvsmdeavess
dvvmllriqnerhqsavsqegylnkygltveraermkrhaiimhpapvnrgveiddslve
seksrifkqmkngvfirmaviqcalqtnvkr

Timeline for d2at2b2:

• d2at2b2 first appeared (with stable ids) in SCOP 1.55
  
• d2at2b2 appears in SCOPe 2.07