Lineage for d2at2b1 (2at2 B:1-144)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156151Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2156152Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2156153Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2156154Species Bacillus subtilis [TaxId:1423] [53675] (1 PDB entry)
  8. 2156157Domain d2at2b1: 2at2 B:1-144 [35198]
    CA-atoms only

Details for d2at2b1

PDB Entry: 2at2 (more details), 3 Å

PDB Description: molecular structure of bacillus subtilis aspartate transcarbamoylase at 3.0 angstroms resolution
PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d2at2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2at2b1 c.78.1.1 (B:1-144) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]}
mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
gdgcgqhptqslldlmtiyeefnt

SCOPe Domain Coordinates for d2at2b1:

Click to download the PDB-style file with coordinates for d2at2b1.
(The format of our PDB-style files is described here.)

Timeline for d2at2b1: