Lineage for d5xk2b_ (5xk2 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. Protein automated matches [190510] (9 species)
    not a true protein
  7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [351938] (1 PDB entry)
  8. Domain d5xk2b_: 5xk2 B: [351974]
    automated match to d1tiaa_

Details for d5xk2b_

PDB Entry: 5xk2 (more details), 1.7000000000000002 Å

PDB Description: crystal structure of mono- and diacylglycerol lipase from aspergillus oryzae
PDB Compounds: (B:) Diacylglycerol lipase

SCOPe Domain Sequences for d5xk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xk2b_ c.69.1.17 (B:) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
pttqledfkfwvqyaaatycpnnyvakdgeklncsvgncpdveaagstvklsfsddtitd
tagfvavdntnkaivvafrgsysirnwvtdatfpqtdpglcdgckaelgfwtawkvvrdr
iiktldelkpehsdykivvvghslgaaiaslaaadlrtknydailyayaaprvankplae
fitnqgnnyrfthnddpvpklplltmgyvhispeyyitapdnttvtdnqvtvldgyvnfk
gntgtsgglpdllafhshvwyfihadack

SCOPe Domain Coordinates for d5xk2b_ are not available.

Timeline for d5xk2b_:

Domains from other chains:
(mouse over for more information)
d5xk2a_