Lineage for d5yoye_ (5yoy E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368727Domain d5yoye_: 5yoy E: [351961]
    Other proteins in same PDB: d5yoya1, d5yoya2, d5yoyb1, d5yoyb2, d5yoyc1, d5yoyc2, d5yoyg_, d5yoyh_, d5yoyi_, d5yoyj1, d5yoyj2, d5yoyk1, d5yoyk2, d5yoyl1, d5yoyl2, d5yoyp_, d5yoyq_, d5yoyr_
    automated match to d5lbsm_

Details for d5yoye_

PDB Entry: 5yoy (more details), 2.73 Å

PDB Description: crystal structure of the human tumor necrosis factor in complex with golimumab fv
PDB Compounds: (E:) Golimumab light chain variable region

SCOPe Domain Sequences for d5yoye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yoye_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvysylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqrsnwppftfgpgtkvdik

SCOPe Domain Coordinates for d5yoye_:

Click to download the PDB-style file with coordinates for d5yoye_.
(The format of our PDB-style files is described here.)

Timeline for d5yoye_: