Lineage for d2atca2 (2atc A:151-305)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873962Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1873963Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1873964Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 1873965Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)
  7. 1873973Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 1874247Domain d2atca2: 2atc A:151-305 [35195]
    Other proteins in same PDB: d2atcb1, d2atcb2
    complexed with zn

Details for d2atca2

PDB Entry: 2atc (more details), 3 Å

PDB Description: crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
PDB Compounds: (A:) aspartate carbamoyltransferase, catalytic chain

SCOPe Domain Sequences for d2atca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atca2 c.78.1.1 (A:151-305) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rlnnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmtrvqkerldpseyabvkaqflvranslgglhnakmnakvlhplprvdeiat
dvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d2atca2:

Click to download the PDB-style file with coordinates for d2atca2.
(The format of our PDB-style files is described here.)

Timeline for d2atca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2atca1