Lineage for d5yo3a1 (5yo3 A:1-106)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. Protein Cytochrome b562 [47177] (1 species)
  7. Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)
  8. Domain d5yo3a1: 5yo3 A:1-106 [351945]
    Other proteins in same PDB: d5yo3a2
    automated match to d1m6ta_
    complexed with so4

Details for d5yo3a1

PDB Entry: 5yo3 (more details), 1.7000000000000002 Å

PDB Description: crystal structure of b562ril with engineered disulfide bond v16c-a29c
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d5yo3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yo3a1 a.24.3.1 (A:1-106) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednwetlndnlkciekadnaaqvkdcltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl

SCOPe Domain Coordinates for d5yo3a1 are not available.

Timeline for d5yo3a1:

Domains from same chain:
(mouse over for more information)
d5yo3a2