Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
Domain d5yoyr_: 5yoy R: [351941] Other proteins in same PDB: d5yoya1, d5yoya2, d5yoyb1, d5yoyb2, d5yoyc1, d5yoyc2, d5yoyd_, d5yoye_, d5yoyf_, d5yoyj1, d5yoyj2, d5yoyk1, d5yoyk2, d5yoyl1, d5yoyl2, d5yoym_, d5yoyn_, d5yoyo_ automated match to d4kfzc_ |
PDB Entry: 5yoy (more details), 2.73 Å
SCOPe Domain Sequences for d5yoyr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yoyr_ b.1.1.1 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvesgggvvqpgrslrlscaasgfifssyamhwvrqapgnglewvafmsydgsnkky adsvkgrftisrdnskntlylqmnslraedtavyycardrgiaaggnyyyygmdvwgqgt tvtvss
Timeline for d5yoyr_: