Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d5vtag_: 5vta G: [351940] Other proteins in same PDB: d5vtaa1, d5vtaa2, d5vtab1, d5vtab2, d5vtac1, d5vtac2, d5vtad1, d5vtad2, d5vtae2, d5vtal2 automated match to d1igml_ complexed with 9k4, edo, nag, peg, pg4 |
PDB Entry: 5vta (more details), 2.8 Å
SCOPe Domain Sequences for d5vtag_:
Sequence, based on SEQRES records: (download)
>d5vtag_ b.1.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qivlsqspailsaspgekvtmtcrasssvcnmhwyqqkpgsspkpwlhgtsnlasgvpvr fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfgggtkle
>d5vtag_ b.1.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qivlsqspailsaspkvtmtcrasssvcnmhwyqqkpgsspkpwlhgtsnlasgvpvrfs gsgsgtsfsltrveaedaatyfcqqwsnhpptfgggtkle
Timeline for d5vtag_: