Lineage for d5tfia_ (5tfi A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870138Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2870139Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
    Uniprot P13569 389-671
  8. 2870151Domain d5tfia_: 5tfi A: [351936]
    automated match to d2pzga_
    complexed with dgt, mg

Details for d5tfia_

PDB Entry: 5tfi (more details), 1.89 Å

PDB Description: nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (cftr) with dgtp
PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d5tfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tfia_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepsegk
ikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivl
geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnlqp

SCOPe Domain Coordinates for d5tfia_:

Click to download the PDB-style file with coordinates for d5tfia_.
(The format of our PDB-style files is described here.)

Timeline for d5tfia_: