Lineage for d1ezzc2 (1ezz C:151-310)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74397Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 74398Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 74399Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 74400Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 74408Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)
  8. 74518Domain d1ezzc2: 1ezz C:151-310 [35193]
    Other proteins in same PDB: d1ezzb1, d1ezzb2, d1ezzd1, d1ezzd2

Details for d1ezzc2

PDB Entry: 1ezz (more details), 2.7 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the t-state

SCOP Domain Sequences for d1ezzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezzc2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplarv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d1ezzc2:

Click to download the PDB-style file with coordinates for d1ezzc2.
(The format of our PDB-style files is described here.)

Timeline for d1ezzc2: