Class b: All beta proteins [48724] (178 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) automatically mapped to Pfam PF00930 |
Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
Protein automated matches [226889] (4 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (8 PDB entries) |
Domain d5vtac1: 5vta C:39-509 [351909] Other proteins in same PDB: d5vtaa2, d5vtab2, d5vtac2, d5vtad2, d5vtae1, d5vtae2, d5vtag_, d5vtaj_, d5vtal1, d5vtal2 automated match to d2gbca1 complexed with 9k4, edo, nag, peg, pg4 |
PDB Entry: 5vta (more details), 2.8 Å
SCOPe Domain Sequences for d5vtac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vtac1 b.70.3.1 (C:39-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifgd sisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsqe ghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspng tflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsstt ttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwncp ttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctfi tkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqyy svslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq
Timeline for d5vtac1: