Lineage for d6cfua_ (6cfu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920500Species Human (Homo sapiens) [TaxId:9606] [188990] (19 PDB entries)
  8. 2920514Domain d6cfua_: 6cfu A: [351897]
    automated match to d5ue7a_
    complexed with mg; mutant

Details for d6cfua_

PDB Entry: 6cfu (more details), 2.24 Å

PDB Description: structure of human alpha-phosphomannomutase 1 containing mutations r180k and r183k
PDB Compounds: (A:) Phosphomannomutase 1

SCOPe Domain Sequences for d6cfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfua_ c.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdevie
kfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfief
rngmlnispigrsctleeriefseldkkekirekfvealktefagkglkfskggmisfdv
fpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcr
eiffp

SCOPe Domain Coordinates for d6cfua_:

Click to download the PDB-style file with coordinates for d6cfua_.
(The format of our PDB-style files is described here.)

Timeline for d6cfua_: