Lineage for d6cg7a2 (6cg7 A:100-207)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. Protein automated matches [190458] (4 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)
  8. Domain d6cg7a2: 6cg7 A:100-207 [351888]
    automated match to d3lnda2
    complexed with ca

Details for d6cg7a2

PDB Entry: 6cg7 (more details), 2.71 Å

PDB Description: mouse cadherin-22 ec1-2 adhesive fragment
PDB Compounds: (A:) Cadherin-22

SCOPe Domain Sequences for d6cg7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cg7a2 b.1.6.0 (A:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndseprflhgpyigsvaelsptgtsvmqvmasdaddptygssarlvysvldgehhftvdp
ktgvirtavpdldresqeryevviqatdmagqlgglsgsttvtivvtd

SCOPe Domain Coordinates for d6cg7a2 are not available.

Timeline for d6cg7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cg7a1
View in 3D
Domains from other chains:
(mouse over for more information)
d6cg7b1, d6cg7b2