Lineage for d6d8wd1 (6d8w D:7-322)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776655Species Influenza a virus [TaxId:947380] [351836] (1 PDB entry)
  8. 2776659Domain d6d8wd1: 6d8w D:7-322 [351882]
    Other proteins in same PDB: d6d8wa2, d6d8wb2, d6d8wb3, d6d8wb4, d6d8wc2, d6d8wc3, d6d8wd2, d6d8we2, d6d8wf2
    automated match to d4wsrd1
    complexed with fmt, nag, oxm

Details for d6d8wd1

PDB Entry: 6d8w (more details), 2.35 Å

PDB Description: crystal structure of invbi.18715.a.kn11: influenza hemagglutinin from strain a/jiangsu/alsi/2011
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d6d8wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d8wd1 b.19.1.0 (D:7-322) automated matches {Influenza a virus [TaxId: 947380]}
vgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvagwilgn
pkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpkatswp
nhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgvhhppt
dsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdtitfea
tgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvtigecp
kyvkstqlrmatglrn

SCOPe Domain Coordinates for d6d8wd1:

Click to download the PDB-style file with coordinates for d6d8wd1.
(The format of our PDB-style files is described here.)

Timeline for d6d8wd1: