Lineage for d5o1ba_ (5o1b A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377723Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2377724Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)
  8. 2377769Domain d5o1ba_: 5o1b A: [351879]
    automated match to d2feja_
    protein/DNA complex; complexed with 9h2, gol, zn; mutant

Details for d5o1ba_

PDB Entry: 5o1b (more details), 1.43 Å

PDB Description: p53 cancer mutant y220c in complex with compound mb84
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d5o1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o1ba_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlrkk

SCOPe Domain Coordinates for d5o1ba_:

Click to download the PDB-style file with coordinates for d5o1ba_.
(The format of our PDB-style files is described here.)

Timeline for d5o1ba_: