Lineage for d3at1c2 (3at1 C:151-310)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493140Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 493141Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 493142Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 493143Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 493157Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)
  8. 493285Domain d3at1c2: 3at1 C:151-310 [35187]
    Other proteins in same PDB: d3at1b1, d3at1b2, d3at1d1, d3at1d2

Details for d3at1c2

PDB Entry: 3at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph

SCOP Domain Sequences for d3at1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3at1c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d3at1c2:

Click to download the PDB-style file with coordinates for d3at1c2.
(The format of our PDB-style files is described here.)

Timeline for d3at1c2: