Lineage for d3at1a2 (3at1 A:151-310)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27322Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 27323Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 27324Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 27325Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 27333Species Escherichia coli [TaxId:562] [53674] (27 PDB entries)
  8. 27431Domain d3at1a2: 3at1 A:151-310 [35185]
    Other proteins in same PDB: d3at1b1, d3at1b2, d3at1d1, d3at1d2

Details for d3at1a2

PDB Entry: 3at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph

SCOP Domain Sequences for d3at1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3at1a2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d3at1a2:

Click to download the PDB-style file with coordinates for d3at1a2.
(The format of our PDB-style files is described here.)

Timeline for d3at1a2: